PNC-27 – Aliquot, 5mg

$149.99

Batch and lot coded with publicly visible lab reports to ensure quality and transparency.
Less than 10% variance in concentration per lot, guaranteeing consistency.
Formulated without corrosive agents for safety.
Formulated with Acetate (counterion) instead of corrosive TFA for safety.
Crimp-top glass aliquot to minimize degradation.
Tamper-proof seal to ensure safety in transit.

Category: Longevity

Application	Binds to HDM-2
CAS	1159861-00-3
Molar Mass	4031.72 g/mol
Chemical Formula	C₁₈₈H₂₉₃N₅₃O₄₄S
Amino Acid Sequence	PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
Synonyms	PNC-27, PNC27
Storage	Store at ≤4°C, tightly sealed, away from heat, light and moisture.
Solubility	Soluble in BAC Water
Organoleptic Profile	White crystalline powder in 3mL glass aliquot
Composition	Each aliquot contains PNC-27, Acetate
Specification	PNC-27 content (per aliquot): PNC-27 5mg ±10%
Terms	This material is sold for laboratory research use only. Terms of sale apply. Not for human consumption, nor medical, veterinary, or household uses. Please familiarize yourself with our Terms & Conditions prior to ordering.

► Necessary Cookies Always Active

Necessary cookies enable essential site features like secure log-ins and consent preference adjustments. They do not store personal data.

► Functional Cookies Remark

Functional cookies support features like content sharing on social media, collecting feedback, and enabling third-party tools.

► Analytical Cookies Remark

Analytical cookies track visitor interactions, providing insights on metrics like visitor count, bounce rate, and traffic sources.

► Advertisement Cookies Remark

Advertisement cookies deliver personalized ads based on your previous visits and analyze the effectiveness of ad campaigns.

Related products