LL-37 – Aliquot

$59.99

Batch and lot coded with publicly visible lab reports to ensure quality and transparency.
Less than 10% variance in concentration per lot, guaranteeing consistency.
Formulated without corrosive agents for safety.
Formulated with Acetate (counterion) instead of corrosive TFA for safety.
Crimp-top glass aliquot to minimize degradation.
Tamper-proof seal to ensure safety in transit.

Application	Agonist of formyl peptide receptor like-1 (FPRL-1), purinergic receptor P2X7, epidermal growth factor receptor (EGFR) and insulin-like growth factor-1 receptor (IGF-1R)
CAS	154947-66-7
Molar Mass	4493 g/mol
Chemical Formula	C₂₀₅H₃₄₀N₆₀O₅₃
Amino Acid Sequence	[LL-37, 37 aa]
Synonyms	CAMP, IPR001894, CAP-18, CAP18, CRAMP, HSD26, gene FALL39, gene LL37, FALL39, LL37, FALL-39, cathelicidin antimicrobial peptide, Cathelicidins, Cathelicidin, LL-37, 154947-66-7, Ropocamptide, Bac4, All38 peptide, Cathelicidin LL 37, LL-37 (Human), hCAP 18, UNII-3DD771JO2H, LL-37 trifluoroacetate salt, LL-37/hCAP18, 3DD771JO2H, CHEMBL530345, LL 37, Cathelicidin antimicrobial peptide 18, AKOS024458536
Storage	Store in refrigerator at 4°C, tightly sealed, away from heat, light and moisture
Solubility	Soluble in BAC water
Organoleptic Profile	Solid, white powder in 3mL glass aliquot
Composition	Each aliquot contains LL-37
Specification	LL-37 content for each variant (per aliquot): LL-37 6mg ±10%
Terms	This material is sold for laboratory research use only. Terms of sale apply. Not for human consumption, nor medical, veterinary, or household uses. Please familiarize yourself with our Terms & Conditions prior to ordering.

Related products